Total number of results for Cricetulus longicaudatus are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02645 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKS
|
30 | Cricetulus longicaudatus | Insulin | Insulin B chain | #Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.#Structure of hamster insulin: comparison with a tumor insulin.# Fed. Proc. 32:300-300(1973). | |
| NP02646 |
GIVDQCCTSICSLYQLENYCN
|
21 | Cricetulus longicaudatus | Insulin | Insulin A chain | #Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.#Structure of hamster insulin: comparison with a tumor insulin.# Fed. Proc. 32:300-300(1973). |